PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G051500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 253aa    MW: 28616.2 Da    PI: 7.6826
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G051500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260104.31.1e-3215112299
               DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                          CaaCk+ +rkC++ C l+pyfp e++++++++h++FG sn+ k++k+l+ ++r++a++sl++eA ++ +dPv+G +g ++kl+++ + lk
  Manes.17G051500.1.p  15 CAACKYVKRKCNECCLLSPYFPVERMADLEAAHRVFGISNMNKMIKRLQVQDRDKAAKSLLWEALIWKQDPVNGPLGQYWKLERENQFLK 104
                          ****************************************************************************************** PP

               DUF260  92 aelallke 99 
                          ++l+l+++
  Manes.17G051500.1.p 105 NQLNLQQQ 112
                          ****9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.69513114IPR004883Lateral organ boundaries, LOB
PfamPF031957.7E-3115111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MPRESNAEPR SKNVCAACKY VKRKCNECCL LSPYFPVERM ADLEAAHRVF GISNMNKMIK  60
RLQVQDRDKA AKSLLWEALI WKQDPVNGPL GQYWKLEREN QFLKNQLNLQ QQVLPYAAMG  120
MQEFNGKETV PNSDFVTNFE TLELDLTMIT GTGNTEQLLS SLSSPLWPNP QDQQCISEER  180
KLPSFRAKEA GNPERSQEIS FCEQGESTVG SNFVHGQQRL TQNTGDFHCP RSAPEPSSRR  240
PEKARTDGSS RS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF147861315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-24LOB domain-containing protein 2